İçeriğe git

PlusOOO Webmaster Forumu'na Hoşgeldiniz!
Forumumuza giriş yaparak tüm fonksiyonlardan yararlanabilirsiniz. Giriş yapabilmeniz için foruma üye olmanız gerekmektedir. Foruma üye olarak konu açabilir,konuları cevaplayabilir,anketlerde oy kullanabilir,anket oluşturabilir,üyelere oy verebilir,mesajları beğenebilir,durumunuzu güncelleyebilir,üyeler arasında özel mesaj alıp gönderebilir ve daha birçok şey yapabilirsiniz.. Eğer zaten üyeyseniz buradan Giriş Yapın - Üye değilseniz buradan Kayıt Olun! Ayrıca üyelik ücretsiz :)

14 Haziran 2013 - Düşecek Domainler Listesi

- - - - - 14 Haziran 2013 - Düşecek Domainler Listesi 14 Haziran 2013 - Düşecek Domainler Listesi 14 Haziran 2013 - Düşecek Domainler Listesi 14 Haziran 2013 - Düşecek Domainler Listesi

Bu konuya henüz cevap yazılmadı
Bu konu 3 aydır (90 Gün) güncellenmemiş. Geçerliliğini kaybetmiş olabilir. İsterseniz yeni bir konu açabilirsiniz..
GsliKahraman
  • Yöneticiler
  • 6.189 İleti
  • 945 Teşekkür
  • Administrator
  • KonumUşak

Ruh Hali: Enerjik
  • Çevrimiçi Süresi: 119 Gün 11 Saat 4 Dakika 15 Saniye
  • Son Aktivite: Bugün, 10:31:17
  • Kayıt tarihi: 05 Tem 2012
14 Haziran 2013 - Düşecek Domainler Listesi

1000-reklam.com
17seo.net
2elgelinlikler.com
333kuyumculuk.org
3elmaanaokulu.org
8ayarkuyumculuk.org
8ayarperakende.org
8kkuyumculuk.org
8kmucevherat.org
acildenizlidesatilikarsalar.com
acildenizlidesatilikdaireler.com
adanadarentacar.com
adanadasatlik.com
adanaemlakcilar.com
adanakresleri.com
adananews.org
adanasatlik.com
agirnastekstil.com
ajan.biz
akabenakliyat.com
akdeniz-anemisi.com
akdenizgroup.info
akemlakadana.com
akillibebekoyunlari.com
akinsaatemlak.com
akpetmersin.com
aksarayhaliyikamatamir.com
aksesuarmania.com
aksoybilgisayar.net
aktifwebbilisim.com
aktvmedya.com
akyaziarshaber.com
alacatisuurunleri.com
alarkokombiservisleri.com
albatros.biz
aldinle.com
alimcocukkuaforu.com
alldizayn.com
almanya-sohbet.com
alperklimaservisi.com
alplerbilisim.com
alsanatatil.com
altinovafm.com
altinsatinal.com
amisosreklam.com
anadoluclub.org
anindapokerchip.net
ankaradayurtlar.com
ankaradekorator.com
ankaradogum.com
ankaradugunrehberi.net
ankarahasema.com
ankarainsaatdekorasyon.net
ankarainsaatonarim.com
ankarainsaattadilat.com
ankaraiwamaaikido.org
ankarakaportaboya.com
ankaranak.com
ankaranakkargo.com
ankaratasarim.biz
anka-sanat.com
anorak.us
antalyaairport-carhire.com
antalya-airport-car-rent.com
antalyaairport-carrental.com
antalya-car-hire.com
antalya-car-rent.com
antalya-car-rental.com
antalyacocukdishekimi.com
antalyadasatilikdaire.com
antalyadishekimleri.com
antalyaikincieloto.com
antalyaotomerkezi.com
antalyapedodonti.com
anulu.net
anzerbali-satisi.net
anzerbal-satisi.net
arabadonanim.com
arbatbilgisayar.com
arcelikkombi.com
argemerkezi.net - PR1
artvinabdioglu.org
asesya.com
asilkinsizler.org
asilkinsizlerenerji.org
asirdekorasyon.com
asirinsaat.net
asirservis.com
aswebtasarim.com
atacanbilgisayar.com
ataemlakinsaat.com
atalarnakliyet.com
ataturkmen.com
ateskombiservisi.com
atesmanekiponlineegitim.com
atikerlpgbayileri.com
atilimusak.com
atlaskariyer.com
atlasotokiralama.net
avcilarinsaatizmir.com
avizeaydinlatma.com
avrupa-sohbet.com
ayanwebtasarim.com - PR1
ayderotelleri.com
aydinkant.com
aydinkresleri.com
aydinlanaydinlat.org
aysaninsaatdokum.com
aysesli.com
babaoyunlari.com
bafrahaberler.com
bahcealemi.info
bahcebalikkas.com
bahcelievlersatilikdaireler.net
bahisofisi.net
balikcifirsat.com
balikesirdehaliyikama.com
ballikuyumculuk.com
balonpatlatmaoyunuoyna.com
banaozelders.com
bandistanbul.org
bankomarka.net
bantmedya.com
barkodyol.com
basarirehberi.com
baskentcambalkon.net
baskently.com
basketbolkardesliktirsendekatil.com
basyazicioglucenter.com
bayankolsaati.info
bayardekor.com
baynetteknoloji.com
bcbilgi.com
bebekim.net
bedavadanal.com
bekoklimaservisleri.com
beldeharita.net
bendenucuzuyok.com
benimoyun.com
bergamafirmarehberi.com
bergamarehberi.net
berringuzellik.com
bersaturizm.com
betssondunyasi.com
beyazciftlik.net
beyazesyaservisii.net
beyazesyatamir.com
beyazinci.org
beydagimutfak.com
beylikduzuajans.com
beypazariurunleri.com
bezbebekoyunlari.net
biatemlak.com
bilgiharmani.net
bilisimderyasi.com
bimix.net
birbulabilsek.com
birdalbilgisayar.com
bireyetiket.com
bireymatbaa.com
bireyselseans.com
birgunlukdaire.org
birlikdilegitimi.com
bitkidesaglik.com
bizbizeguzellik.com
blogbacklink.com
bocekilaclamaservisleri.com
bolge-servisi.com
boluosmanlinargile.com
boomistanbul.com
boranturkuevi.com
boschbeyazesyaservisleri.com
bosuna.net
botoyunlari.com
bozkurtsevdasi.com
btmobilyatasarim.com
bucantakacmaz.net
buldukiste.biz
bulutcebe.com
burdurgundem.com
burhaniye-emlak.com
burhaniye-satilikarsa.com
burhaniye-satilikdaire.com
burhaniye-satilikyazlik.com
burhaniye-satilikzeytinlik.com
bursabalcatasimacilik.com
bursacom.com
bursakresleri.com
bursaphotographer.net
bursapil.com
bursareklamrehberi.com
bursatarimmakinalari.com
bursatemizliksirketi.net
bursauludagotelleri.com
busemcanta.com
buyukkilicozelegitim.com
buzhane.net
cadikazani.biz
cakirsigorta.net
cambridgeozeldilegitim.com
canakkaletours.com
canlarsohbet.com
canliizle.org
canotokurtarma.com
capariemlak.com
carpediemcicek.com
caskurlugiyim.com
catalcadasatilikarsalar.com
catigayrimenkul.net
catlak.biz
cazakupon.com
cengelkoyhuzurevi.info
cengizticaret.com
cerkezkoyajans.com
cevabi.net
chatcafem.com
chatsanali.com
choicechangeseverything.com
christelleambulance.com
cicekciara.org
cicekcibul.org
cicekcidukkani.org
cicekmarketim.org
cicekonline.org
cicekpasaji.org
ciddisohbet.net
cipmu.com
cocukkuaforleri.com
cocukkumpanya.com
cografyaogretmenim.com
comfortmasasandalye.com
craftistanbul.org
crysis2forum.net
cv-ornekleri.net
dapoxtin-turkiye.com
degisimobilya.com
dekorbutik.com
demetkaytanlahayatkalitesi.com
demirbileklojistik.com
demircimuhgayrimenkul.com
demirdokumservis-tr.com
demirelahsap.com
demirpalet.com
denizliproduksiyon.com
dijitalfirsat.com
dinamikanadoluasansor.com
dinihaberler.net
dislerdunyasi.com
distedavileri.com
divrigigazetesi.com
dizaynahsap.com
diziaktuel.com
diziizle-hd.com
dizinox.com
dogadaaramakurtarma.org
domainfuari.net
domuzoyunlari.com
dortyolakdenizemlak.com
dresuarmodelleri.com
drhakanguven.com
duniaservis.com
dunyakabir.com
dunyaspor.net
dusuncevegorus.com
e-alvesat.com
e-avatar.com
e-boschservis.com
ebuzu.com
ecaygayrimenkul.com
e-ciftlik.net
e-cimri.com
edirnenakliye.com
editortanitim.com
edremitkorkmazemlak.com
e-emdgayrimenkul.com
egaguvenlik.org
egeemlakofis.com
eglencemalzemeleri.com
e-icisleri.com
ekinozelegitimrehabilitasyon.com
ekipguvenlik.com
ekodestek.org
ekolkirmizi.com
ekolojikyalitimsivasi.com
e-konyarehber.com
ekotasemlak.com
ekotoaksesuar.com
elalemsanatevi.com
elazigmem.com
elittabela.com
elmasvekiymetlitasborsasi.info
elmasvekiymetlitaspiyasasi.info
eltemizlemekremi.net
emarinmedya.com
emir-mutfak.com
emlakalem.com
emlakgorkem.com
emlaksitenizolsun.com
emogencnigde.com
empaemlak.com
emsesli.net
emulsiyonbakimcihazi.net
enbainsaat.com
eniyicicek.info
enucuzparcakontorbayiligi.com
enver.cc
e-ofismobilyalari.com
e-pide.net
epidemictekstil.com
e-plugin.com
e-profiloservis.com
erbaabilgisayar.org
ercelikotoservis.com
erciyesotogaleri.com
erdemirpeyzaj.com
eregliticaret.com
erenmobilya.info
erkektakiaksesuar.com
erkinsizler.org
erkinsizlerenerji.org
eruyayorumlari.com
e-ruyayorumlari.com
ervamutfak.com
esekoyunlari.com
esenbayraktekstil.com
eskisehireleman.com
eskisehirotomobil.com
eskisehirotomotiv.com
eskisehirwebyazilim.com
e-standart.net
eticareting.com
etiketpolen.com
etkiliyorum.com
euroturk-barter.com
evalanaaraba.com
evdeisimkanlari.org
evdenevenakliyatbalikesir.com
evdenevenakliyatcanakkale.com
evden-eve-nakliyatim.com
evdenevenakliyatmarmaris.com
e-vestelservis.com
evmevimmutfak.com
evmmutfak.com
evtadilatdekorasyonu.com
ev-yapgayrimenkul.com
exportiselbiseleri.com
fatihsarigulmobilya.com
ferditayfurdinle.net
ferolleturkiye.com
festivalizmir.com
fethiyemedya.com - PR3
fibasigortanet.com
film-izle.tv
filmizlefulldizi.com
film-izletr.net
filmizleyekmi.biz
filmtvseyret.com
filmveoyun.net
finaloyunlar.com
firmalataza.com
firmaport.net
firmasor.com
firsatcibalik.com
firsatmi.com
fishrestaurantistanbul.com
fissatisi.org
fistikfirsat.net
fistikozubaklavalari.com
fordumaparca.com
forumdunya.net
forumzade.com
frenbalatalari.com
futboldergisi.info
galoy.net
gapticaret.net
garajturk.net
garantiemlakci.com
garantiotoservisi.com
gayrimenkulpark.com
gazelsesli.com
gazetehaberciajansi.com
gaziantepacikhavareklam.com
gaziantepacikhavareklamciligi.com
gaziantepkopekegitim.com
gaziantepkresleri.com
gecelikbayanarkadas.com
gelendekorasyon.com
gelindunyasi.com
gelinlikdavetiyecesitleri.com
gelinlikdavetiyemodelleri.com
gemasonlinealisveris.com
gezendunya.com
giresunissektoru.com
giyimblog.com
gizlengez.com
globalmerkez.org
gokogluinsaat.com
gonulemlak27.com
gonyeligazetesi.com
googlereklamhizmeti.net
go-outdoorsturkey.com
gozoyunlari.com
grafikpremium.com
grupdekorasyon.com
gruponarevi.com
gucludekorasyon.net
gulensohbet.com
gunzturk.com
gurbetinyagmuru.com
guvenelektrikmuhendislik.com
guvenlikilokontrol.com
guvenmakina37.com
guven-spot.com
guzelliginizfarkedilir.com
gxlbilgisayar.net
haberdivrigi.com
haberholdings.com
haberkulup.com
haberturkmen.info
habibinsaat.com
haciminsaat.info
halpekinsaat.com
hanfnaturkosmetik.org
hardalmedya.com
haskoroglunakliyat.com
hastahaklari.info
hastanerandevual.com
hastanerandevugovtrvatandasindex.com
hataybilet.net
haydikacirma.org
haydiyuvaya.com
hayyinsaat.net
hazirwebal.com
hddizi.info
hd-emlak.com
hdgayrimenkul.net
hediyebuluruz.org
hediyelik8ayar.org
hediyelikaltin.org
heidarbabalojistik.com
helalbelgeleri.com
hepsinialacam.com
hileleri.tv
hizirdemirci.net
hizliilan.com
hobox.net
hollanda-sohbet.com
hopsa.net
horozoyunlari.com
hsbcmagdurlari.com
ibrahimbeybutikhotel.com
iddialive.net
igrenc.org
ihracatburada.com
ikincielotomobiller.net
ilkemutfakbanyo.com
iloveshopinistanbul.com
ilyadadizayn.com
imalattangiyim.com
implantdestek.com
implantservis.com
imrozreklam.com
inaytambayan.com
incigiyim.net
indiroyunlar.net
ingilizceozelegitim.com
ingilizceturkcesozlukler.net
ingilizceyiseviyoruz.biz
ingilizkemaldizisi.net
ingilizkulturatasehirjunior.com
insaatasansorleri.com
insaatdekorasyonankara.com
insaatsilikonu.info
insan-kaynaklari.org
insider-istanbul.com
ipadfirsati.com
iphonefirsati.com
iranturkiye.org
iskiyafetcisi.com
islamihazan.com
islamoglusut.com
islamsesi.com
ismakinasiyedekleri.com
istanbulcnc.com
istanbuldreamtours.com
istanbulevdebakim.com
istanbulhatun.info
istanbulkiralikdaire.org
istanbulpaintballturnuvasi.com
istanbulpiks.net
istanbulshotel.biz
istanbulshotel.info
istanbulsotel.biz
istanbultekstilportal.com
istanbultransportation.info
istanbulunyildizi.com
istikbalmobilyamodelleri.net
istikbalmutfak.net
iydgiyim.com
iyialisverisler.info
iyicicek.info
izleamabizle.com
izletelimmi.com
izmiravcilarinsaat.com
izmirbitkiselshop.com
izmirdedemirci.com
izmirfitness.com
izmirfotograf.com
izmirfotografkursu.com
izmirguzelliksalonu.net
izmirkurslar.com
izmirtravel.info
izolasyon.tv
juorganizasyon.com
kabainsaat.org
kabilsavaslari.com
kablosuzaydinlatma.com
kadinseninadin.com
kadinuyaricidamla.com
kahramanotogaleri.com
kalpoyunlari.com
kampanyarehberim.com
kapadokyabalonfirmalari.com
kapkacsigortasi.com
kapkanfilm.com
karadenizden.net
karadenizforum.org
karadenizoptimum.info
karainsaatemlak.com
karakasmedya.com
karamancinarevleri.net
karamanhaber70.com
kardelenekoturizm.com
kareasmedya.com
kargiturizm.info
kartaldasatilikdaireler.net
kartonpiyerdekor.com
kavacikbilgisayarservisi.org
kaysericit.com
kayseri-kayseri.com
kayseripanelcit.com
kayseriyapiotomasyon.com
kcdekor.net
keciorenferrolikombiservisi.org
kekcicekleri.info
kenttasmantolama.com
kibrisarazi.com
kickboxizmir.com
kilovebeslenmeurunleri.com
kinaaksesuarlari.com
kinsizlerdenizcilik.org
kinsizler-elektrik.com
kinsizlerelektrik.net
kinsizler-enerji.net
kinsizlerinsaat.org
kinsizlermuhendislik.com
kinsizler-muhendislik.com
kinsizlershipping.org
kinsizlershipyard.org
kinsizlertersanecilik.org
kinsizler-trafo.com
kinsizlertrafo.net
kinsizlertrafobakim.net
kiralikminubus.net
kirklarelibalkancup.org
kiyamamsesli.org
kiymetliteknikservis.com
kiziltoprakalimcocukkuaforu.com
kocaelicepte.com
kocaelihabermerkezi.info
kocaelisineklik.com
kocaelitesisat.com
kolayingilizceci.com
komericanlife.net
komikkeris.com
konaklamavetatil.org
konserorganizasyonu.org
konuanlatimvideo.com
konyabembirsen.org
konyaharbis.org
konyakentsurucukursu.com
kosgebprojedestekleri.com
koskdoviz.com
kuaformuratkaya.com
kuantumlifeturkey.com
kumuzik.com
kupajans.com
kursmerkezi.net
kurtburda.com
kurumsalsanatakademisi.com
kurumsalsporakademisi.com
kurumtakip.com
kurutemizlemeantalya.com
kusadasitatilim.com
ledleaydinlatma.com - PR1
legoturk.com
lezzetturk.net
livinginturkey.net
lw6090altincilek.com
magazinemlak.com
malatyadernek.com
malatyakresleri.com
malatyaotokiralama.org
maltepedeanaokulu.com
maltepedesatilikdaire.net
manisapetmarket.com
mapservis.com
marasakdeniz.com
maraztemizlik.com
markacicekci.com
markaturko.com
maurers-turkiye.net
mehmetonturk.com
memurlarburada.net
mersinimrehber.com
meshursivaskofte.com
mesuticaret.com
mesutoyun.com
metamuzik.com
mevzubahis.net
millaninsaat.com
milletvekilleri.biz
misinainsaat.com
mitsubishiklimaservisii.com
mobilsatisnoktasi.com
modacastajans.com
morenaydinlatma.com
moretto-turkey.com
moretto-turkiye.com
motoroyunuoyna.com
mssorganizasyon.com
mucevheronline.net
muglaalem.com
muhendismaaslari.com
mulkiyeeskisehir.org
muratdisticaret.com
muzikafe.org
muzikbu.com
muziklas.com
muzikwear.com
nakkasbolu.com
nakliyatkibris.com
nakliyatmanisa.com
nakliyatsamsun.com
nakliyattrabzon.com
natureantalya.com
naturheilmedizin.biz
nazaremlaksaray.com
nazosesli.com
necipgayrimenkul.com
nedvijimostantalya.com
netborsa.com
netkinsizler.org
netkinsizlerenerji.org
nidaaluminyum.com
nigdeisdunyasi.com
nimetmodaevi.com
notebookhastanesi.org
nrtguvenlik.com
nuremekinsaat.com
nuvihediyelik.com
ocakgiyim.com
ofmmedya.com
ofsetci.com
oknoservis.net
okuldonanim.com
olensevgilim.biz
olimposkonutlari.com
olimpossitesi.net
oliti.com
olumkuyulari.com
omurboyu.biz
onarm-ankara.com
onlinevideoizle.net
onnumarahaber.com
organizasyonelit.com
ortechguvenlik.com
or-techguvenlik.com
orumcekoyunlari.com
osmaniyeimaj.com
osmaniyeotomatikkapi.com
osmaniyewebtasarim.com
osmanogluinsaat.net
otobeyintamiri.org
otocentermersin.com
outletalisveris.info
overtasarim.com
oyun41.com
oyunlus.com
oyunoynamakistiyorum.com
ozbulurmuhendislik.com
ozdemirgayrimenkul.com
ozdesemekanik.com
ozelbilgiler.org
ozel-firsat.com
ozelfirsatim.com
ozelsiirthastanesi.com
ozelsporcularaozelsporlar.com
ozkarabalikelektronik.com
ozkinsizler.org
ozkinsizlerenerji.org
ozlemardahan.com
pabuccenter.com
pabucino.com
pacoz.net
pakni.com
panoramikalbumsistemleri.com
papaganturleri.com
parfumerim.info
pastahane.org
paylasimforum.com
pazarmall.com
pegaeticaret.com
pekayinsaat.com
personelalimilanlari.com
petwebtasarim.com
pibes.net
pinarticaret.net
pireklam.net
pirlantavealtin.com
pixeldizayn.com
platformguvenlik.com
poetikhaber.com
pointblankturkiye.org
pozorajans.com
profesyonelfotocekimi.com
programtanitim.org
psfirsati.info
quantumlifeturkey.com
radyoboyut.com
radyoezgiler.com
radyofeys.com
radyoreyhan.com
radyotvnet.com
rastgele.biz
ravzatekstil.com
reklamuzmanim.com
rekreasyonuzmani.com
renkservis.com
renksigorta.com
reventinturkiye.com
reventinvucutbakimseti.com
ruslarkadarguzeliz.biz
sacdokulmesinionlemek.biz
sacdokulmesinionlemek.info
sac-dunyasi.com
sacveciltbakimi.org
safakdemircelik.com
safranlojistik.com
saglamgayrimenkul.com
saglamormanbahce.com
saglikegitimenstitusu.com
saglikhukuku.info - PR2
saglikkabini.net
sagliklibina.biz
sagliklibinalar.biz
saglikliev.biz
saglikpedia.org
sahibindenbesiktasemlak.com
sahlanemlak.com
sakaryacity.com
sakaryaozelhastane.com
sakaryaozelhastanesi.com
saklambacanaokulu.com
salongunlukleri.com
saluturkmed.org
samandagbilisim.com
samp-turkiye.com
samsunevdenevetasimacilik.com
samsunhaberler.net
sananaokulu.com
sanzimanparcalari.com
sapsiz.com
satispostasi.com
satma.info
sbajans.net
scriptevi.net
seffafsayfa.org
sehirceki.com
selcombilisim.net
senaydinlatirsingeceyifilm.com
senyildizkampanyalari.com
seografi.com
seramikhediye.com
serpantin.net
serpentturkiye.com
servethalimobilya.com
servis-merkezi.net
sesakozmetik.com
seslicerenim.com
seslimood.com
seslioje.net
seslioysa.com
seslisahne.com
seslisehirforum.com
sesliserap.com
seslislogan.com
seslisohbetiniz.org
seslisozluj.com
sesliyesevdaliyiz.com
sevgililergunucicek.com
sezginvatansever.com
shoppingtouristanbul.com
sidratasimacilik.com
siemensboschservisi.net
sifamerkezi.net
sifresizssksorgulama.com
sigortaborsasi.org
siirtvakfi.org
silivridesatilikarsalar.com
sinavkolay.com
sinavuzmani.com
sinayorganizasyon.com
sivaskombiservisi.com
sivasticaret.com
sivasyurt.com
sivilceoyunlari.com
skornet.net
sohbetji.net
sohbetsohbet.net
sokaktanmoda.com
solucanoyunlari.com
sorgulama-tr.net
sormadanal.com
sorularivecevaplari.org
sossuzmedya.com
sosyalhizmetler.net
sosyalokuyucu.com
soyakmagdurlari.com
soyluinsaatizolasyon.com
spojevi.org
sseslisohbet.net
stolfagrafik.com
stoxgayrimenkul.com
sulama.info
suleymankaraca.com
sunucugames.com
sunucuspiker.com
superder.com
superindirim.net
surprizdunyasi.com
survivortatil.com
suskunlardizisi.biz
tadilat-ankara-dekorasyon.com
tadilat-dekorasyon-ankara.com
takiminadestekol.com
takip-iz.com
takipuzmani.com
tamfilm.com
tarifdenizi.com
tarihgezginleri.com
tarisuzumpazarlama.info
tatbilgi.com
tatilayi.com
tatlimsesli.com
tattilbizle.com
technoturkish.com
tekdizizle.com
tekirdagnakliye.com
teknocultura.com
teknoguide.com
teknologs.com
teknosanguvenlik.com
teknosman.com
teknoturkiye.org
tekno-yapi.com
telefon-telefon.com
tempogayrimenkul.com
tercumemerkezi.com
terk.info
terrariaturkiye.com
tezanalizimerkezi.com
tgnturk.com
theperaistanbul.com
thesosyal.net
tilkioyunlari.com
toktekstil.com
topalliinsaat.com
toptanguvenlik.com
torrentfilmoyun.com
trabzonsesli.com
trfragman.com
tupbebekmerkezleri.org
turanturkistan.com
turkeylim.com
turkeytravelworld.com
turkflowers.info
turkinfra.com
turkishmachineequipment.com
turkishmachinetool.com
turkishmachinetools.com
turkishpolicy.org
turkishwearshop.com
turkiyedebaris.com
turkiyefuesacekimi.com
turkiyemobil.com
turkiyesinema.com
turkiyya.net
turkkartaltim.com
turkmenbook.com
turkmenhaber.info
turkomanya.com
turkpiks.com
turkuaz-proje.com
turkulersusmaz.biz
tutkunkardeslerhurdacilik.com
tuykalemminyatur.com
tuzlakinsizler.org
tuzlakinsizlerelektrik.org
tuzlakinsizlerenerji.org
tuzlakinsizlermuhendislik.org
tvfirsati.info
tvtanitim.org
tvtatilvizyon.com
twittertakipciarttirma.com
uckan-insaat.com
ucuzlermakina.com
ufrsegitimleri.com
ukashkartdestek.net
ulusalkanserhaftasi.org
understandingturkey.com
universitesozluk.com
uzmantelekom.com
velik.net
veske.net
videoizle27.com
videoizle5.com
videoparazit.biz
vipdemet.com
vitrincamlari.net
vizyongarden.com
waffleistanbul.net
webtasarimistanbul.biz
webtasarimizmir.biz
webtensatis.com
webturka.info
weddingdunyasi.com
wildboarhuntingturkey.com
wwwseslisalon.com
yabancidilsinavlari.org
yabancimuzik.org
yakamozdatatil.com
yalovakinsizler.org
yalovakinsizlerelektrik.org
yalovakinsizlerenerji.org
yalovakinsizlermuhendislik.org
yamacgayrimenkul.com
yarasa.info
yasaninsaat.com
yedibolgedenhaber.net
yenikinsizler.org
yenikinsizlerelektrik.org
yenikinsizlerenerji.org
yenikinsizlermuhendislik.org
yenimedya.tv
yenitabela.com
yeroyunlari.com
yesilvadiemineller.com
yikamaoyunlari.net
yildirimcagrimerkezi.com
yilmazlargayrimenkul.net
yoncachat.com
yuceicgiyim.com
yucekayainsaat.com
yucememlakinsaat.com
yufun.net - PR2
yuzbakimim.com
zamanfilm.net
zanenwaterworldsuaritmasistemleri.com
zrvgayrimenkul.com
zumrutmodaevi.com

3 ve 4 Karakter Domainler

1su.org
1wk.net
2sq.org
39m.net
3gq.net
3p8.org
72k.net
7oy.net
81l.org
87v.net
8v2.net
8v4.net
9685.org
9784.org
aetb.net
ahlx.net
ahrv.org
ahyf.org
aij.info
ajdi.net
aje.info
ajgh.net
ajl.info
ajvh.net
annp.net
atvi.net
atvj.net
axcq.net
axtx.net
ayyz.org
bbdj.org
bbgd.net
bdoi.org
bgt.cc
bicm.net
bjpo.org
btha.net
buit.org
bvvv.net
bygy.net
cbg.cc
cbh.cc
ccdm.net
cfmd.net
cihr.org
cldt.org
coy.cc
coyb.net
cpzg.com
cr8.net
cvga.net
cwel.org
cxy.mobi
d6l.net
dflx.org
dgly.net
djn.info
dmgb.net
dsla.net
dttd.net
dwr.biz
dyy.cc
e75.net
eeau.net
egld.net
egv.info
eja.info
ejk.cc
erml.org
eu0.org
ezuz.net
fcrg.org
fdd.mobi
fgme.net
fgmt.net
fiod.net
fnqi.com
foh.mobi
froe.org
fwq.cc
fwwb.org
ghlt.net
gktu.org
gmon.org
gotd.org
gouj.net
gqrw.net
gvmi.org
gwku.net
gwqb.net
gytt.net
gzbh.net
gzzw.org
hamd.org
he8.org
hgpc.org
hihm.net
hnds.net
hpxs.net
hsgg.net
htuc.net
hwb.cc
igtp.net
irjp.net
j6c.net
jao.info
jdcj.net
jfrj.net
jljw.org
jno.info
jpbe.net
jpfs.org
jsg.info
jsig.com
jtjt.net
jtr.info
juad.net
juao.net
jwnx.net
jxna.net
jysu.net
jzbj.org
kapy.org
kbsu.net
kppt.org
kv8.org
kya.cc
kyzs.org
kzew.net
laop.net
ldif.net
ljbz.net
ljjy.com
lnea.org
lpio.org
ltlu.org
lvds.net
lxms.net
lzqy.net
lzrt.net
mgsj.org
mhzn.net
mjkz.net
mkcn.org
mmjh.net
mong.org
mrwj.net
mshw.org
msrk.net
mtm.biz
mxic.net
mygc.org
nayo.org - PR1
ndhp.org
nfpd.net
ngne.net
njkl.net
nksq.net
nmrc.net
nrch.net
nrpe.net
ntcn.org
ntwt.net
nwjz.net
nwwo.net
ohn.info
oiho.net
oojh.org
oul.info
owtm.org
pdaf.net
pdsv.org
phqd.com
pje.info
plpt.net
pmao.org
pnyt.net
poj.info
prtk.net
ptjy.net
pwp.mobi
pyjm.net
pztw.net
q4l.net
qaaz.com
qate.net
qinx.org
qjtt.net
qljz.net
qsls.net
qtbb.org
qxhd.net
qxhq.net
renv.org
rgj.cc
rjjd.net
rlyq.net
ruo.info
s3z.net
segm.net
sewx.net
sgpj.net
sm3.net
snri.org
spnl.net
ssuj.net
svfr.net
syxy.org
taml.net
tcrd.org
tczw.net
tghk.net
tinp.net
tjyx.net
tkdp.net
tudo.org
txlu.net
txtv.org
ucny.org
ucwa.org
udpe.org
uemx.com
ulaf.net
ulsx.net
utft.net
utpf.org
v3j.net
vegb.net
vgsa.net
visk.org
w8r.net
wdlt.org
wdpy.net
wfja.net
wfnr.net
wijd.net
wio.cc
wkjp.net
wof.cc
wuhl.net
wxyp.net
wyz.cc
xfsw.org
xggc.net
xkki.net
xnml.net
xsqy.org
xtoc.net
xudk.net
xvne.com
xvod.net
xwmy.net
xyfp.net
y5s.net
yhbh.org
yhck.com
yijy.org
ykhy.org
ylfx.net
ylgu.net
ylqp.net
yltd.org
yora.org
ytla.net
ytwj.org
yvyr.com
ywes.org
yzsk.net
z8c.net
zgym.org
zhdm.org
zhvc.net
zlpp.org
znpx.net
zsld.org
zwe.mobi

Kaynak : Domain Forumlar

Resmi ekleyen




Benzer Konular :

  Konu Başlatan Durum Son İleti Bilgisi



0 Kullanıcı konuyu okuyor

0 Kullanıcı, 0 Misafir, 0 Kayıtsız kullanıcı

Elinizde Bulunsun
Kullanışlı Araçlar
PlusOOO © 2012 - 2013
PlusOOO Webmaster Forumu
Öneri ve şikayetleriniz için iletişim sayfasını kullanarak bizimle iletişime geçebilirsiniz.

Bir forum sitesi olan plusooo.com webmaster forum sitemizde, forum kullanıcıları 5651 sayılı kanun'un ilgili maddesine ve T.C.K'nın 125. maddesine göre yaptıkları paylaşımlardan sorumludur, kullanıcı bazlı herhangi bir durumdan plusooo.com sitesi ve site yetkilileri sorumlu değildir. Tüm hukuksal bildirimleriniz için [email protected] adresi ile iletişime geçebilirsiniz bu çerçevede, plusooo.com yönetimi en geç 10 iş günü içerisinde dönüş yapacaktır.

hosting


IPB skin by IPBForumSkins
.
DMCA.com Creative Commons Lisansı